SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29739.m003741 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29739.m003741
Domain Number 1 Region: 15-362
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.52e-117
Family IF2B-like 0.0000000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29739.m003741
Sequence length 382
Comment Methylthioribose-1-phosphate isomerase, putative
Sequence
MANNSNSGSELEVDDTLQSICYNRGSLKLLDQRKLPLETEFLDIRNSSDGWSAIREMVVR
GAPAIAIAAALSLAVEVFNFDDFTGTSNDAASFLFKKLEYLVSSRPTAVNLSDAANKLKE
VIYKAAATASDSNSVFQAYIEAAEIMLKDDIASNKAIGSHGASFIQNQLKNPQRLSILTH
CNTGSLATAGYGTALGVIRALHAAGVLRRAYCTETRPFNQGSRLTAFELVHEKIPATLVA
DSAAAALMKDDQVSAVIVGADRVAANGDTANKIGTYSLALCAMHHNIPFYVAAPLTSVDL
SLSSGKHIVIEERSPKELLNSRGGLGEQVAASGISVWNPAFDVTPANLISGIITEKGVIT
KIDSSDFDIKNFVKRTAGQSVA
Download sequence
Identical sequences B9RR88
XP_002516257.1.68434 29739.m003741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]