SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29929.m004759 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29929.m004759
Domain Number 1 Region: 855-1080
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000163
Family Tropomyosin 0.0023
Further Details:      
 
Domain Number 2 Region: 1076-1271
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000719
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29929.m004759
Sequence length 1987
Comment ATP binding protein, putative
Sequence
MSESNDSVELSLQNGEEEEAEEEKEEPSSNGHVVDPQIYINQELEQEQEEVNHVDSKEDM
FVDAADDIEDNQFQEMDNNGDTDNEVNQDDKDTVSKEYKEEREQISKEVANLLHQLKNLS
NNEDSEELVCGSGSLNEMMSECSQYVKVSLEQKLQTENMIRKLQQQIEELNMKIQVEQNV
DMVADRVLGVLNMVVNQEELVDYSVIGKLAHVERSTYLLVEQYRWFLYEVDKLRHCLVEG
GFSVGQHEEFGYEFAVARNQLLELKKTEAEMLGKVSYLEDVNRKLVEEVEKEKEMAGIVN
SEFEKVKMELEQEKNRYANTKEKLGMAVTRGKALVQQRDSLKQSLAEKTSELEKCLVELQ
EKSNVADSAELCRGELAKCENLAATLQETLSQRNAVLESCEEFLSHTSVPEELQSLDITD
KLKWLVNQVASLQETVLQNNAVFQTSNEIFSQISISEDIESMDMIERLKGLVNLVTSLQE
MISQRNKILISLEDMISEVNAPVELQSMDAVQRFKWIMEERDALKSNLLEFHRLKDALSL
IDIPETTSSSDLETRIGWLKDSVKQAKDEINMLQEEIARTKEAAHKEIDSLSGALLAELQ
EKEYAKMELDELAQKYEEISQEAHQASLEKDQMVRLLLEGSGIEDTYSDVATLVERCFGK
VKEQSTASSFDASPADAEVFERIQSLLYVRDLELMFYAKFLEEDALVQLEVNNLSNELRV
ASVELAALKEEKDSLRKTLEQSEERSALLKEKLSLAVKKGKGVFQDLKNLKLTLDDKNSE
IEKLKLELQHQESAMSECRDQISRLSADLEQAQKLEADLVDMKNQRDQFEQFLLESNSML
QRVIESVDRIVLPPDLDFEEPIEKVNWLAGYMNECQIAKSKAEQELGNIKEETIIMAGKL
AEAEESIKYLEDALSASENHISQIAEEKQEIEVAKENIEQDLKKAKEEAHAQTSNFNEAC
ATRKSLEDALSLAENNISLFVKEKEEAQLSRAATETELEKVREEAAVQTEKLTEAYRTIK
SLEAALSQAEVNGSLLSEQNNHFQVERTDLENELKKLKEEAESHASRLEDTTTTMKQLEE
AKLSRAAMETELEKAREEVAGQTEKLTEAYRTIKSLEVALSQAEANITLLSEQNSLFQVG
RTDLENELKKLKEEAESLACRLADTSITIKQLEDAQLGRAATETELEKVREEIAFLTEKL
TEAYSTIKSLEDALSQAEANISLLSEENNHFQVGRIDLESELEKLKEKATSQASRLADTS
ATIKSLEDALSKAGNIISGLEGEKRIAEQEISALNSRLRAYMDELPGTNGSLENRSAELI
HHLGDIQMLVRNERLLSMARQHFEEEFEKLRNMDLILRDIKGHLVNKSSEVLPSHPIMEE
DLHLIKPFPHDLGNIIDTEMDDSNLNAADVDSISKLLKKTVEEFQLRNSNLVGNFDGFFT
FITELIDALLVKLRVTKDAVANIFEHMEFVKQKMMNMEMDKGEQDKTIAMLEKDCRVLLS
ACANATSRLQFEVKNNLLDLCSIPELEKLKNSMIPEVTELDSDEMEHGSRYENMAEILLL
AARKVHTLTKLFESTSNVAASTIEDLQKKLRESRAAYESTIEERDMIQKRVSKLETDVDI
LQNSCKELRLKTEDYQVIEEKLKETEAELLHNNLSMKEQEAEHVLMSPSELKTLYDKIRK
VEIPNVESEVGDLESHNLVDVQKLFYIIDSASELHHQMNTLSHDKDKLQSTLAMQVLEIE
HLKEEIETLIRNNQESEKAKTEIAEVTLVLDKIISMLGGSEIVGDQKSASAQRLLPLVEK
QITALIWEAKNSKSEAQELGARLLGSQKVIDELSTKVKLLEDSFESKTVAPEIVQERRIF
EAPSLPTGSEISEIEDVGPVGKNTISPVASAAQLRTMRKGSTDHLVLNVDSESASLINNE
ETDEDKGHVFKSLNTSGLIPKQGKSLADRIDGIWVSGGRILMSRPRARLGLIAYCLVLHL
WLLGSIL
Download sequence
Identical sequences B9RMQ4
XP_002515023.1.68434 29929.m004759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]