SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29981.m000578 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29981.m000578
Domain Number 1 Region: 7-95,159-389
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.14e-78
Family IF2B-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29981.m000578
Sequence length 412
Comment translation initiation factor eif-2b beta subunit, putative
Sequence
MPETQTLINEFVTNLRKRKIDGSQATALRTAELLRSVISHLKAPQANQASALIDAVKNVG
VQLIAANPAELATGNIVRRVLHIIREEELSLVTNDEEVMKKEDSHIQSTAGRSLLRQPSL
HTLLDCKPDSTITDDLYPIGEGFEVKGKSSERSSKIWKLKNDVIEGINELIQELNNCHEH
IAEQAVELIHQNEVILTLGRSRTVMEFLFAAKEKRRSFRVFVVEGAPKYHGHVLARELAE
RGLQTTLIPDSAVFAMISRVNMVIVGVHAVMANGGVLGQVGLNMVALAARKHAVPFVVVA
GTHKLCPLYPQDPRVILNEMKCPSDLLDFGGLSDCLDFGNGSGVPLIHIVNPAFDYVPPE
LVSLFITDIGGHNPSFMFRLLADYYSANDLILHSLVADHWILYKCKKGRKET
Download sequence
Identical sequences B9SS46
29981.m000578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]