SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 30131.m007212 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  30131.m007212
Domain Number 1 Region: 7-95,176-350
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.12e-68
Family IF2B-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 30131.m007212
Sequence length 442
Comment translation initiation factor eif-2b beta subunit, putative
Sequence
MPDVQALVNDFLNKLKKRKIEGSQATAKQTAEVLRSVISQQRVPYTNQAAALIDAVKAVG
EQLIAANPVELAVGNIVRRVLHIIREEDLSLTTAAIAGLNLAAVSDDDDDGERDDHPVLS
AAAVAAAARSTLRPPSLQTLLEDMPDSAAIPHTSSSGGDSEGKSKSADKSSRSRKLKHDV
IESVNELIQDIAMCHEQIAEQAVEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVFVA
EGAPRYQGHLLVKELVARGLQTTLITDSAVFAMISRVNMVIVGAHAVMANGGVIAPVGLN
MVALAAQKHAVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDFGSGTG
SPLLHVVFDKLNTMQFTNSICITVEGTIRPTCIDLLLIITLLMIWWCNEDLPQGIDSHQT
SKSMWQFRNYHGRGGLEIKEIN
Download sequence
Identical sequences B9RGC3
30131.m007212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]