SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 30147.m014396 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  30147.m014396
Domain Number 1 Region: 75-118
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000000000000454
Family Rubredoxin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 30147.m014396
Sequence length 170
Comment electron transporter, putative
Sequence
MAALHAPSRLQASMSTPLPSLLAPISSNAGLRPPPDRFALKSSFFSPSLHLLLPSNQHRP
LAAAAPRFSMRVASKQAYICRDCGYIYNERTPFEKLPDKYFCPVCGAPKRRFRQYTPTVN
KNDNQTDTRKARKAQIQRDEAIGRALPIAIVVGVVALAGLYFYLSSSFQG
Download sequence
Identical sequences B9RA53
XP_002511078.1.68434 30147.m014396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]