SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 30167.m000858 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  30167.m000858
Domain Number 1 Region: 285-631
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.58e-91
Family IF2B-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 30167.m000858
Sequence length 638
Comment translation initiation factor 2b, delta subunit, putative
Sequence
MDPRRASRTVSDPKVRQVGFFTPGASSPDRSQSGPPDPHPISSSPPTITDLSPSSGNSLS
PVMIPPPRHVSAPLSPLLRDSAPPGTMVNSNSNNATELFTAATSPTATTSFSDSGRGGTA
PSSSYPGGGGVGGLDMPQTSSSVPGSGLTTVSVFVNLPPGLDEKAGISTDVQNSNRSNLK
RLKEKTTKAERRALQEAQQAAKAAAKAEGAAIPANAKLAKSAKVPSQKNDNAPTAASEKK
GGEHPPEKDRKKDVPQPRMQYDDKSRVEKAKKRAVVKQTEARNRVELFRHLPQYEHGTQL
PDLESKFFQLDPMHPAVYKVGLQYLSGDVCGGNARCIAMLQAFQEVINDYSTPPEKTLVR
DLTAKIGSYVSFLIECRPLSISMGNAIRFLKNRIAKLPLTLSEAEAKATLHADIDCFIYE
KIIVADKVIVKHAVTKIRDGDVLLTYGSSSAVEMILLHAHELGKQFQVVVVDSRPKLEGQ
LLLRRLLGKGISCTYTHINAVSYIMHEVTQVVLGASSVLSNGTVYSRVGTACVAMMAHAF
HVPVLVCCEAYKFHERVQLDSICSNELGDPDAISKVHGRDEINFLGGCATSENMQLLNLI
YDATPSEYVSMIITDYGMVPPTSVPVIVREYRREHWWI
Download sequence
Identical sequences B9S5D3
XP_002521202.1.68434 30167.m000858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]