SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|72383997|ref|YP_293351.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72383997|ref|YP_293351.1|
Domain Number 1 Region: 428-524
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|72383997|ref|YP_293351.1|
Sequence length 562
Comment Sulfate transporter/antisigma-factor antagonist STAS:xanthine/uracil/vitamin C permease:sulfate transporter [Ralstonia eutropha JMP134]
Sequence
MHPTDSARGGSPMRDVIAGCSIAGLLLPEAVAYAGIANLPPQAGLIGLLIGLVVYGLLGT
SRFAVVSATSSSAAVLAAITVSMAGVDLAQRLLLAGGLVILSGFFLVLAGVARLGGITEF
IAKPVLRGFTFGLAITIILKQVASVAGVHPTHGDLPRFTYELIQELAVWNMNGLIAALVV
LLLLFAMSRWKNVPGPLVVIVLGIMLAHGVDMHHYGISQVGTIDLANVSFDIPDLPRAQW
LRLGELAFALVLILYAESYGSIRSFALKYGDKTSADRDLVALGVANLGSGLLHGMPVGAG
YSATSANEAAGARSRLAGWCAAVVVAMIVALLLPQLALTPEPVLAAIVAYAVSHTLRLSV
FRPYWAWRRDRLLVVAACVAVLLLGVLDGLLAGIGVSLLITLRNFSEPNVSQLGRLGSSH
DYVDITAHPEARTLPGVLIVRPEAPIFFANVERILAQVRHLADAGPGAVHTLIFSLEESP
DLDGSTIEALHAFAAGATASGRRLLLVRLKPPALEVLSRSADEALPREALHELSVDECVQ
SLGQGGVAAATKAPGPAVEGSR
Download sequence
Identical sequences Q46MY1
264198.Reut_C6179 gi|72383997|ref|YP_293351.1| WP_011295936.1.84135 gi|72383997|ref|YP_293351.1|NC_007336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]