SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73538685|ref|YP_299052.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73538685|ref|YP_299052.1|
Domain Number 1 Region: 629-805
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.16e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 1-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.76e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0039
Further Details:      
 
Domain Number 3 Region: 498-637
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.6e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Weak hits

Sequence:  gi|73538685|ref|YP_299052.1|
Domain Number - Region: 791-834
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0647
Family Regulator of G-protein signaling, RGS 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73538685|ref|YP_299052.1|
Sequence length 853
Comment assimilatory nitrite reductase (NAD(P)H) large subunit [Ralstonia eutropha JMP134]
Sequence
MKLIIVGHGMVGHKFLECLAEAGAQNLDVTVLCEEPRPAYDRVHLSEFFAGKSAEDLSLV
PAGFFEQHNNILLRLNARAVSIDRAARTVTVSTGETLAYDKLILATGSYPFVPPVPGKER
KDCFVYRTIEDLEAMRECGARSKRGVVIGGGLLGLECAKALRDMDLETHVVEFAPRLMAV
QVDEGGGRMLRQKIEGLGVTAHTGKNTVEIIDGADGTHRMVFADGTHLDTDMIVFSAGIR
PRDELARAAGLAVGERGGITVDNNCRTSDPDVYAIGECALWQGKIYGLVAPGYDMARVAA
RHLRGEAAEFAGADMSTKLKLMGVDVASIGDPHGTVPGARLYQFSDDSKQVYKKLVVSDC
GKYLLGGVLIGDASEYGTLLQMMLNKIELPESPEFLILPDSSGKAKPALGADALPDTAQI
CSCNNVSKGEICAAVCDGATSIGAMKSCTKAGTACGGCVPLVTQIMKAEMKKQGMAVNNH
LCEHFPYSRQELYHLVRVGKFKTFDALLEAHGKGLGCDICKPTVGSILASCWNEFVLKEE
HAALQDSNDYYLANIQKDGTYSVVPRMPGGEVTPEGLIAVGQVAKKYGLYTKITGGQRVD
LFGARAEELPYIWEELIAAGFESGHAYGKALRTVKSCVGSTWCRYGVDDSVGLAIELENR
YKGLRAPHKIKFGVSGCTRECAEAQGKDVGVIATEKGWNLYVCGNGGMKPRHAELLAGDL
DRDTLIRYIDRFLMFYVRTADRLQRTSVWRDNLEGGLDYLKDVVLDDKLGIAADLEAEMQ
HVVDTYEDEWKKAVTDPETRKRFRHFVNSERRDDNLVFIEERGQIRPATPEERNLQRSRL
SHIPVVAVPAKAA
Download sequence
Identical sequences Q46RM6
WP_011300974.1.84135 264198.Reut_B4860 gi|73538685|ref|YP_299052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]