SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73538807|ref|YP_299174.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73538807|ref|YP_299174.1|
Domain Number 1 Region: 441-545
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.37e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73538807|ref|YP_299174.1|
Sequence length 552
Comment Sulfate transporter/antisigma-factor antagonist STAS:xanthine/uracil/vitamin C permease:sulfate transporter [Ralstonia eutropha JMP134]
Sequence
MIALREAWQAGLFHRGNWFPNIVAGAIVGVVALPLAMAFAIASGAKPEQGLYTAIVAGLL
VSACGGSRVQIAGPTGAFIVILSGITAKHGIDGLQIATLMAGLILLAMGLARLGSVIRFI
PAPVIVGFTAGIGVIIFVGQWRDFFGLPAVAGEHFHEKLWHLLQVFPQLHVATTAIAVLS
LLLVVGAPRVHWLRRIPGPLLALVAATAIQAVFRFEGVATIGSAFGGLPRGLPGLSLPEV
TLARVIELAGPAFTIAMLGAIESLLSAVVADGMAGTRHDSNQELMGQGLANVVAPLFGGF
AATGAIARTATNIRNGGNSPLAGITHAVTLVLVVLFLAPLAANVPLAALAAILFVVAYNM
SELRHFARMVRRAPRADVAILLITFSLTVLTDLVVAVNIGVILAMLQFLRRMSVSVEVSR
QDAPDLEHELSRDGGTPPGLPPGVLVYGIDGPFFFGAVENFERALIQTHTDPRVLLIRLR
RVPFMDMTGLQTLDEVIGKLRERGVAVVLCEANARVRQKLMRAGVLAALGEANYQDTLAA
AAERCAQLAREQ
Download sequence
Identical sequences Q46RA4
264198.Reut_B4982 WP_011301096.1.84135 gi|73538807|ref|YP_299174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]