SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73539921|ref|YP_294441.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73539921|ref|YP_294441.1|
Domain Number 1 Region: 4-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.46e-101
Family Methylenetetrahydrofolate reductase 0.000000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73539921|ref|YP_294441.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Ralstonia eutropha JMP134]
Sequence
MQDRYYSFEFFPPKTAEGAEKLRNTRAQLAPLNPKYISVTFGAGGTTQQGTLDTVLEIQR
EGIEAAPHLSCVGSSRESIREILQQYRDGGIRHIVALRGDMPSGMGEIGEFRYANELVEF
IRAETGDWFQIEVAAYPEYHPQAKSPRHDLENFVRKVKAGANSAITQYFFNADAYFRFVD
DARAMGVDVPIVPGIMPITNYSQLMRFSDMCGSEVPRWVAKRLESFGDDRESIRAFGLDV
VTALCERLLAGGVPGLHFYTLNAAGATKAIWQRLKL
Download sequence
Identical sequences Q476T6
WP_011296405.1.84135 264198.Reut_A0215 gi|73539921|ref|YP_294441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]