SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73542801|ref|YP_297321.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73542801|ref|YP_297321.1|
Domain Number 1 Region: 20-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73542801|ref|YP_297321.1|
Sequence length 117
Comment sulfate transporter/antisigma-factor antagonist STAS [Ralstonia eutropha JMP134]
Sequence
MQAPAFVQLVFSELAGFANPTFTMLSLGTSLTNQNAAAVLRDGLSRVARGETQVDCAALE
QVDSSAVAVLLAWQRAAAARQGKLALSGVPRQLAELASLYGVDSLLGLAPQAAAHRH
Download sequence
Identical sequences Q46WK6
264198.Reut_A3117 gi|73542801|ref|YP_297321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]