SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73543022|ref|YP_297542.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73543022|ref|YP_297542.1|
Domain Number 1 Region: 646-1114
Classification Level Classification E-value
Superfamily ALDH-like 4.58e-131
Family ALDH-like 0.000000289
Further Details:      
 
Domain Number 2 Region: 263-618
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.06e-121
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000241
Further Details:      
 
Domain Number 3 Region: 89-262
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.07e-65
Family N-terminal domain of bifunctional PutA protein 0.000000149
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000156
Family PutA pre-N-terminal region-like 0.00082
Further Details:      
 
Weak hits

Sequence:  gi|73543022|ref|YP_297542.1|
Domain Number - Region: 1150-1304
Classification Level Classification E-value
Superfamily ALDH-like 0.0982
Family ALDH-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73543022|ref|YP_297542.1|
Sequence length 1322
Comment trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Ralstonia eutropha JMP134]
Sequence
MATTTLGVKLDDASRDRLKRVAQSIDRTPHWLIKQAIFTYLEQIERGHLPHEAMAGGAGE
ADGADGAEMSHADGAPQPFLEFAQSIQPQSVLRAAITSAYRRPETDCVPVLLEQARLPQQ
QAEAAIKMAKKLATALREQKVGTGREGLVQGLIQEFSLSSQEGVALMCLAEALLRIPDKP
TRDALIRDKISGANWQSHLGQSPSLFVNAATWGLLLTGKLVATHTESGLSKALTRIIGKG
GEPLIRKGVDMAMRLMGEQFVTGETISEALANARKYEAQGFRYSYDMLGEAAMTEEDAQR
YLASYEQAIHAIGQASRGRGIYEGPGISIKLSALHPRYSRAQHERVINELYERLKSLTLL
ARQYDIGINIDAEEADRLEISLDLLERLCFEPELAGWNGIGFVVQGYQKRCPFVIDYLID
LARRSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYVACARKLLSVPDA
IYPQFATHNAHTLSAIYQIAGHSYYPGQYEFQCLHGMGEPLYDQVVGPIADGKFNRPCRI
YAPVGTHETLLAYLVRRLLENGANTSFVNRIADDTISLDELVADPVAVVETMHRDEGTLG
LPHPKIPSPRGLYGKSRANSAGIDLANEHRLASLSSALLAGTSERVVADPMLGTEVPRAA
DAITTPVLNPADHRDVVGQVTEASQADVDAALQAAANAAPIWQATPPDVRASALERAADL
MEAQMQSLMGIIMREAGKTFSNAIAEVREAVDFLRYYAAEVRRSFDNETHRPLGPVVCIS
PWNFPLAIFTGQVAAALAAGNTVLAKPAEQTPLIAAAAVRILREAGVPAGAVQLLPGRGE
TVGAALVGDARVKGVMFTGSTEVARILQRNIAGRLDAAGRPIPLIAETGGQNAMIVDSSA
LAEQVVGDVVNSAFDSAGQRCSALRVLCLQEDVADRVLAMLKGAMNELTMANPDRLSTDV
GPVIDEEARGNIVRHIDAMRAKGRRVHQADPNAPQGASCRHGTFVPPTLIELDSIDELKR
EVFGPVLHVVRFPRAALDTMIGQINGTNYGLTMGIHTRIDETIAQIVQHAEVGNLYVNRN
IVGAVVGVQPFGGEALSGTGPKAGGPLYLHRLLSVCPQDAVVRSVRHAEASGNPPAAPER
PVAAQALKDWAKTEMPEVAAACDRFAEASAAGISVTLRGPTGERNTYSLLPRHHVLCLAA
QEQDLAIQLAAVLAVGSQAVMAENPVSRGLFARLPKGVQSRVRIVSDWTSPEPAFDAVIH
HGDSDQLRTVCEQVAARPGPIIGVQGLAQGEPNIALERLLIERSLSVNTAAAGGNASLMT
IG
Download sequence
Identical sequences Q46VY6
264198.Reut_A3340 WP_011299467.1.84135 gi|73543022|ref|YP_297542.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]