SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73539557|ref|YP_299924.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73539557|ref|YP_299924.1|
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.14e-34
Family Sfri0576-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73539557|ref|YP_299924.1|
Sequence length 130
Comment hypothetical protein Reut_B5736 [Ralstonia eutropha JMP134]
Sequence
MIEILEGFPGNVVAVRASGEVTRDDYERVLIPAVDAAMKGHDKIRVYYELGPGFTRMSAG
AAWDDLKLGVAHYWHWEAVAVVTDHDWIRRAIDVFRFVVPAHVRTFPDDQAAEARDWIVS
ALDKPTTRPS
Download sequence
Identical sequences Q46P54
372642 WP_011301842.1.84135 gi|73539557|ref|YP_299924.1| 264198.Reut_B5736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]