SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73542776|ref|YP_297296.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73542776|ref|YP_297296.1|
Domain Number 1 Region: 21-294
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.4e-94
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000313
Further Details:      
 
Domain Number 2 Region: 363-456
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 5.49e-18
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0013
Further Details:      
 
Domain Number 3 Region: 295-337
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000000111
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73542776|ref|YP_297296.1|
Sequence length 467
Comment cytochrome b/b6, N-terminal, partial [Ralstonia eutropha JMP134]
Sequence
MAAEKQVKTTGLLGWIDARFPATQLWEDHLSKYYAPKNFNFWYFFGSLALLVLVIQIVTG
IFLVMNYKPDGTLNSAGIPVAFASVEYIMREVPWGWLVRYMHSTGASAFFVVVYLHMFRG
LLYGSYRKPRELVWIFGCLIFLCLMAEAFMGYLLPWGQMSYWGAQVIVNLFSAIPVIGQD
LSLFIRGDYVVSDATLNRFFSFHVIAVPLVLLALVVAHIIALHEVGSNNPDGVEIKAKKD
ENGIPLDGIPFHPYYSVHDTLGVAGFLVIFSAVIFFFPEVGGYFLEANNFFPADPLKTPP
HIAPVWYFTPFYSMLRATTSNFLPILWVFFALVLGMLFVRSKDARIKAASIAIAVILAVG
FYFIDAKFWGVLVMGGSVVVLFFMPWLDCSPVKSIRYRPAFHKTILIVFVVVFLVLGYLG
VQPPSPVGEKVSQLGTLLYFAFFLTMPLWSRAGEFKPVPERVTFHPH
Download sequence
Identical sequences Q46WN1
gi|73542776|ref|YP_297296.1| WP_011299235.1.84135 264198.Reut_A3092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]