SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Chro.10149 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.10149
Domain Number 1 Region: 281-361
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 2 Region: 15-83
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000687
Family Eukaryotic type KH-domain (KH-domain type I) 0.006
Further Details:      
 
Domain Number 3 Region: 198-266
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000258
Family Eukaryotic type KH-domain (KH-domain type I) 0.0096
Further Details:      
 
Domain Number 4 Region: 96-186
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000119
Family Eukaryotic type KH-domain (KH-domain type I) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Chro.10149
Sequence length 460
Comment hypothetical protein
Sequence
MLNILKVGDNQTIAQIESADASFIVGTGGRTRRKLAAVSGTSITIIQDDSKTARVEINGD
AACREKAYLYLKYLVQQKHGPVTIDVTPDSRDDLTIVNVPALCVGYITGKKGQGLRAIEE
DSGTLMFFSRPEEECPTDSTPPSNGVPMNNGNSQSQYILAIFGVARNRRAAELRVMCYIE
QKINGHFTKDLKAESHDHIEDLATDIVHIETEDLSYAVGKEGNTRRRLCASSGAIIEYVG
NFAFIHGDLSERKRAKEYLAWLIAQRTSTVSVDTRAREDVTVVSIPQNVIGYVTGAKGSF
LRRVEDETGTFIFIDENKGNVLERVLIFSRSAFGRQKARDFIERRMYEKLCGYADNKNYP
PNGNGFNSRNMNGIRKTNGITLNNSHFDHPMKGNFAAIPNAFLSQPGISGLGAPNMGIGR
RSRTRGGAPEHHISDKSSGKPAGLYGGNLVPFGLSGGALF
Download sequence
Identical sequences A0A0S4TC75
Chro.10149 gi|67624295|ref|XP_668430.1| 237895.Q5CNM8 XP_668430.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]