SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Chro.20308 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.20308
Domain Number 1 Region: 144-212
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Chro.20308
Sequence length 1132
Comment hypothetical protein
Sequence
MWHPNVSGHNEGLETISTMNPLAKVGPTEKKQKGKVRSGPTNSSNQRRAGTRFSNNPNLQ
TQSHVPTQPSPVSGVAVGPMPIPVSASNSLGIGNINSPSLNSIGVPGNIVVAPPINQPSQ
GQTVSYRNTKKIPIDRSKFHPSISNLAGAIIGVSGSNQKWMEQESGAQVQILGTTGNDPE
GLHILVRYNEPRELEIVEAIIEEIGRATFEGGGGFISHILPNRKPVSPTLTGLQGNMIVS
AALQDHTSGIEKQIMGSGVAMGGMPSLPPNYSSSQPLYNNMSSNIGMGFIPRGNIVAPIQ
IEWPKTPPASPVEFEWLLHLVLHSALSQLGPMVSHGVPMIHIPMLYDSFTSFRFEHDATS
FFQSCIIQNGLLGLIQALPHIFIEGPHTIIDSSNIPKLSPIFKVNLSSGVTPLLLPAQSV
TVSFADFKLAAEAFWKMGALPPTFSGFGPQVPQNINGTSGPSGLAVTGSTGTISDHVYNT
SSVVSPNQSARQHQGKDSSGSSIGENVLAGGTNKIKKDQGANSIINTNSNQPTKGSSLIS
DDDDTFGIDNSSSKNGVITNGTSSVALSSHSSTTTTSSGVTSIVNVGKDNIPQTSLMIVL
QGVHFLLRRWISKRLAPHYIPKSSLDFLPLDILESEFSQFYEIPLNIEILGWTNLLHFVE
AFPDVWTVENVGPDEFTLIPLPYPDFSMIAKTRGITKLNNEKHYDSKPDSNAFTLSAQGS
SLANIHKSGGSLDNIQKIVKQTQDFVAEAIASGYPANSLEINSINEIINGVTMGIYSLDN
NTSSSLYELVTKVTNLLPKYSSNSASSTSTNFPNKPISGSISKSRFDNAYKGTNGIGSMN
GLAKGTKSGGFQHQPHSLQPPTAYPSTHISLANEKSILGGSGNHHSLTVPQVGASRFNSM
NNAKNEIRYDIGAAQPMSTHNQHNIHLHAPHQTNAQVLNSNLSTGRSVNGGQSKRVFSNQ
CAGASKGPKQLVGQDQRPYPLYDQQGSNPSTEFVNLQHNPNHMNPTQNTFGMQEASESNI
HNFYHHSMDGNSHFSTYNGGGISSIGNSMAASCHYDYHSFGVQSTNSAFVQPSQNHSMNG
AHFSKSVGIPSDQTIGNNGNNNGNNIMLSLPNHASVVSNRSGWDRKNKSKNN
Download sequence
Identical sequences A0A0S4TC73
XP_667170.1.74355 gi|67611650|ref|XP_667170.1| 237895.Q5CK15 Chro.20308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]