SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Chro.80193 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.80193
Domain Number 1 Region: 117-208
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Chro.80193
Sequence length 212
Comment YOR3513c
Sequence
MGETKSMDMDMVEERRTEGPFKPLTGTEVNRSNEIRRVMVPENRMTPLKNQWINIVTPLV
EHMGLHVRMNTKRRCVELKYGPDCTDIGSLQKGVDFIKAFLLGFELQDAIALLRLDDLYI
ESFEIKDVKRLNGAHLSRCIGRISGRDGKTKYAIENSTRTRIVLAGQKLHLMGAFHNIKL
ARDALCSLILGTPPGKVYNHLRIVSKRVQEKL
Download sequence
Identical sequences A0A0S4TJZ2
gi|67608568|ref|XP_666887.1| Chro.80193 237895.Q5CJ75 XP_666887.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]