SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Chro.80348 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.80348
Domain Number 1 Region: 38-141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.94e-25
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Weak hits

Sequence:  Chro.80348
Domain Number - Region: 1-42
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000386
Family Cold shock DNA-binding domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Chro.80348
Sequence length 144
Comment hypothetical protein
Sequence
MKSILDEGDVICTEVQRVQSEGICHLHTRSAKYGKLANGMVVKVPNKLIQRQAQHIVKLK
YGIQLILGLNGYVWISLPFEHSHTDTLNYSSSSVKPEIVNSNIRKSIVMLAFIIKLFGLK
NMQITPERICKVFDRFTELHLSYK
Download sequence
Identical sequences A0A0S4TKC1 A3FPZ0
Chro.80348 XP_001388431.1.25317 XP_667071.1.74355 237895.Q5CJQ5 gb|cgd8_2980 gi|126117371|gb|EAZ51471.1| gi|126654521|ref|XP_001388431.1| gi|67609946|ref|XP_667071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]