SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000312 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000312
Domain Number 1 Region: 24-290
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.07e-80
Family Carbonic anhydrase 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000312   Gene: ENSRNOG00000037983   Transcript: ENSRNOT00000000312
Sequence length 323
Comment pep:known chromosome:Rnor_5.0:11:90811893:90814786:-1 gene:ENSRNOG00000037983 transcript:ENSRNOT00000000312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALGFRLCFLLMLAAQVDSNGTWCYDSQDPKCGPAHWKELAPACGGPTQSPVNIDLRLV
QRDYALKPFIFHGYDSAPQDPWILENDGHTVLLRVHSCQQNCPAIRGAGLPSSEYRLLQL
HFHWGSPGHKGSEHSVDEKHGSMEMHMVHMNTKYQSMGHARSQPDGLAILAVLLVEEDKD
NTNFSAIVSGLKNVSSPGVSVNLTSTFALASLLPSALGLLRYYRYSGSLTTPGCEPAVLW
TVFENTVPIGHAQVVQFQAVPQTGPPGLHPRPLTDNFRPQQPLGGRRISASPGASIRSSV
PIRPCLHLALLGLGVGLRLWQGP
Download sequence
Identical sequences D3ZBQ6
ENSRNOP00000000312 10116.ENSRNOP00000000312 ENSRNOP00000000312 NP_001099371.1.100692 NP_001099371.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]