SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000553 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000553
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily Prefoldin 7.19e-27
Family Prefoldin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000553   Gene: ENSRNOG00000000473   Transcript: ENSRNOT00000000553
Sequence length 127
Comment pep:known chromosome:Rnor_5.0:20:7514596:7516060:1 gene:ENSRNOG00000000473 transcript:ENSRNOT00000000553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQN
AKAPGKA
Download sequence
Identical sequences Q6MGC4
ENSRNOP00000000553 ENSRNOP00000000553 NP_001158190.1.100692 NP_001158190.1.4139 NP_997671.1.100692 NP_997671.1.4139 10116.ENSRNOP00000000553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]