SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001305 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001305
Domain Number 1 Region: 1124-1263
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.96e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000165
Further Details:      
 
Domain Number 2 Region: 245-332
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000871
Family Calponin-homology domain, CH-domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001305   Gene: ENSRNOG00000000986   Transcript: ENSRNOT00000001305
Sequence length 1269
Comment pep:known chromosome:Rnor_5.0:12:4296404:4319735:1 gene:ENSRNOG00000000986 transcript:ENSRNOT00000001305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEAAPAGSGPLRRTFLVPEIKSLDQYDFSRAKAAASLAWVLRAAFGGAEHVPPELWEPF
YTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLEPSPSPSALLALLARRGTVPSLPEH
PVREADLKHQPILMGAHLAVIDALMVAFSFEWTKTLPGPLALSSLEHKLLFWVDTTVRRL
QEKTEQEATQRASPAAPLDGASPAQPSHAIAFCLKESGNKPPMIRYRKDRAIARRAPCFP
NVTTLQDLASGAALAATIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASHLPRG
CPLSLEDLLYVPPPLKVNLVVLLAEMYMCFEVLKPDFVQAKDLPDGHAVSPRNTETVPSQ
NNSGSSSPVFNFRHPLLSPGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQA
VSFSTPFGLDSDVDVVMGDPVLLRSVSSDSLGPPRPALTSSRNSAQPPPESGDLPTIEEA
LQIIHSAEPRLLPDGAADGSFYLHSPEGLSKPPLASPYPPEGASKPLSDGLNKAPIYISH
PENPSKPSPCSAGETLKPPPPSEGSPKAVASSPAANNSEVKMTSFAERKKQLVKAEAESG
TGSPTSTPVAPEALSSEMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQP
REAAGEAEEEAELGSVPGGERPAGEGQGEPSSRPKSVTFSPDLGPIPPEGLGDYNRAVSK
LSAALSSLQRDMQRLTDQQQRLLAPPEAPGPAPPPAAWVIPGPATGPKAASPSPARRAPA
ARRSPGPGPSPTPRSPKHARPAELKLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSS
ILLSEGTPPEEPTTKPALIEIPLASLGEPAAEEEGDGSPPGAEDSLEEEASSEGEPRSGL
GFFYKDEDKPEDEMAQKRASLLERQQRRAEEARRRKQWQEAEKEQKREEAARLAQEEAPG
LALSAPVAPAAPVATLAPATRAMAPAEEEVGPRRGDFTRLEYERRAQLKLMDDLDKVLRP
RASGTGGPGRGGRRATRPRSGCCDDSALARSPARGLLGSRLSKVYSQSTLSLSTVANEAP
NNLGVKRSTSRAPSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKS
NKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETE
ELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKPTT
PKKGGGTPK
Download sequence
Identical sequences D3ZXQ2
NP_001138312.1.100692 NP_001138312.1.4139 ENSRNOP00000001305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]