SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001401 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001401
Domain Number 1 Region: 298-362
Classification Level Classification E-value
Superfamily RILP dimerisation region 4.05e-20
Family RILP dimerisation region 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001401   Gene: ENSRNOG00000001055   Transcript: ENSRNOT00000001401
Sequence length 406
Comment pep:known chromosome:Rnor_5.0:12:39361410:39398925:1 gene:ENSRNOG00000001055 transcript:ENSRNOT00000001401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPLGSPPAALSALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRV
LEILEVLVSRHHVAPELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLL
SQIAQLQEENKQLMTNLNHKDVGFSEEELQKHEGMSERERQVMKRLKEVVDKQRDEIRAK
DRELVLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEM
GSLRAELGKLRERLQGEHSQNGEEEEAEIPPQPDGEESISDAEKAALDLKDPNRPRFTLQ
ELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHPRTSPQPESGIKRLF
SFFSRDKRRLANTQRPTHIHESFGQWAITHRDDGYTEQGQEALQHL
Download sequence
Identical sequences D3ZUQ0
NP_001178594.1.100692 NP_001178594.1.4139 10116.ENSRNOP00000001401 ENSRNOP00000001401 ENSRNOP00000001401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]