SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002373 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000002373
Domain Number 1 Region: 23-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.66e-113
Family Transferrin 0.000000291
Further Details:      
 
Domain Number 2 Region: 365-704
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.13e-112
Family Transferrin 0.000000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002373   Gene: ENSRNOG00000001739   Transcript: ENSRNOT00000002373
Sequence length 738
Comment pep:known chromosome:Rnor_5.0:11:75210907:75232739:-1 gene:ENSRNOG00000001739 transcript:ENSRNOT00000002373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLSVTFWLLLSLRTVLCVMEMQWCTISDPEQQKCKDMSKAFQGAGIQPSLLCVQGTST
DHCVQLIKDQKADAITLDGGAIYQAGKEYGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVT
INTLKGVKSCHTGINRTVGWNVPVGYLVETGHLSVMGCDVLKAVGDYFGGSCVPGAGETS
HSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGKALMSQDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRDDMDGGLIFRLLNEGQ
LLFSHEDSSFQMFSSKAYGQKNLLFKDSTLELVPIATQNYESWLGQEYLHAMKGLLCDPN
RLPHYLRWCVLSVPEIQKCGDMAVAFSRQSLKPEIQCVSAESPEHCMQQIQAGHIDAVTL
RGEDIYRAGKAYGLVPAAGELYAEEDRSNSYFVVAVVRRDSSYSFTLDELRSKRSCHPGL
GSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEK
GRNKCVGSSQERYYGYSGAFRCLVENAGDVAFLKHTTVFENTNGHNPEPWASHLRWQDYE
LLCPNGARAEVDQFQACNLAQMPSHAVMVHPDTNIFTVYGLLDKAQDLFGDDHNKNGFQM
FDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQCSGAGAAVHRVP
PPALLLLALAAGLLPRVL
Download sequence
Identical sequences D4ADK7
ENSRNOP00000002373 NP_001099342.1.100692 NP_001099342.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]