SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002921 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000002921
Domain Number - Region: 96-196
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0847
Family YicI N-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002921   Gene: ENSRNOG00000002135   Transcript: ENSRNOT00000002921
Sequence length 320
Comment pep:known chromosome:Rnor_5.0:14:36936116:36951529:1 gene:ENSRNOG00000002135 transcript:ENSRNOT00000002921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAAAATEQQGSNGPVKKSMREKAVERRNVNKEHNSNFKAGYIPIDEDRLHKTGLR
GRKGNLAICVIVLLFILAVINLLITLVIWAVIRIGPNGCDSLEFHESGLLRFKQVSDMGI
IHPLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVEKNKTSITSDIGMQFFDPRTQNI
LFSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGNEGVFIMGKT
IEFHMRGDVELKAENSIILNGTVMVSPTRLPSSSGGDQSGSGDWVRYKLCMCADGTLFKV
QVTSHNMGCQVSDNPCGNTH
Download sequence
Identical sequences A0A0G2K1V7
ENSRNOP00000002921 10116.ENSRNOP00000002921 ENSRNOP00000002921 NP_001177997.1.100692 NP_001177997.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]