SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002978 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000002978
Domain Number 1 Region: 1161-1430
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.14e-25
Family Quinoprotein alcohol dehydrogenase-like 0.017
Further Details:      
 
Domain Number 2 Region: 1355-1644
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.84e-18
Family WD40-repeat 0.019
Further Details:      
 
Domain Number 3 Region: 977-1204
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.61e-18
Family WD40-repeat 0.019
Further Details:      
 
Domain Number 4 Region: 394-642
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000128
Family Nucleotide and nucleoside kinases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002978   Gene: ENSRNOG00000002190   Transcript: ENSRNOT00000002978
Sequence length 1742
Comment pep:novel chromosome:Rnor_5.0:14:45938969:46347907:-1 gene:ENSRNOG00000002190 transcript:ENSRNOT00000002978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPAGAGTKQLCARDSALRRAAFSGNLTALPSHLVPAGRSVRVFISANPEDTGAERQALR
ETVYPKLREFCRENYGLEFQVIDLYWGVEEDEWDSPELQKMRMKLLEECLKSSAGPCFVG
LLGEKYGNIRIPGQVEASEFEMILDAAVEAKLETKLLEDWYCRDENSVPAAYYLRPRLEV
PRTNKNSTQPSATGEHERPWQEISDEIKTIFKAATKLLHEQGKMKLSQAKRYLFSAIEDE
FDFALGKQTPAFLKKCVCXRXXXRLIERFVKIPEMGKYMDITGTDPRIIRDPEAQEKLIK
LRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYIEGLGKQFYEDMIDIIQATVQQ
NFDTETDTLYDEILQHSSLCKTYASFYEYKCESLNILHKYILPSKTGHINPLIVYGGPCT
GKTLLLAEVAKKAYGWLHEDTGPDSDPVVIVRFLGTTDMSIDLRTLLLSVCEQLAVNYRC
LVQSFPKKIHDLRDLFINLLNESSLQRPLVIIFDALEQLSETDEARKLWWLPAHLPRFVR
IILSTLPNKHGILQKLRCLIHEEDNYIELIPRDRKMCSQVLKHQLLRVKRKVTSGQQIYV
NNAFSKCTLPMFVNLTFREVRHWRSHKDVNESSLCVTVHESIEQLFWSLEKKCGQKLVSR
ALGYITMAKMGLSEMELEDVLALDNSVMNELIENTRPSNPLRVPYLYIARLKEGLNGYLI
ERHVKNVTLLVWANRHLQLIAQKLYLQEDSNLREMHTILADYFLGVWSGGRRKAFCLEDP
YLNGCLDLENRSLLEEEKHFIEQASFDRQAPDQPWVFQCNPLEPDIFFVNHRKMSELLYH
LTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLADIELAYNYSQEKELKFLASTLRGIR
NKVITFPGSLSAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSPER
LPLASSHLHVTEILPTCNPSTVLTALENGSISTWDVETRQLLRQITTAQSVILGMKLTSD
EKYLVVATTNNTLLIYDNVNSCLLSEVEIKGTKHGSSPTYINGFTLSINHALAWLEASKD
VTVIDLLYGWPLYQFHCWYEVTCVQCSLDGVYAFCGQYLNNTTIFHLGSGEKICTVTSEF
SGGFVKFLLILDTAQEMVMIDSEGSLSVWNTEDISSPQLTEDFDCRKEDSEVVSIELSED
QSAILICKALSIELLDTGMWKVAEKFRARHNERFISAVLSKNGDCIIATMENTPAVFFWR
RDTGQCMASLKEISGTIVKLVKSSHHNMLLSLSTSGVLSIWDIDIITAMSNIDKTGKPIQ
SLVLPARGEIIYSLDGSDCVHKWNFSSGFIEAVFKHEGIVEHCVLTSAGDIMVTSDDKSS
QYVWHTSSGENLFRINGQRISQLLITHNDQFVVSLCEENASRVWRLATGHRVCNILTTLQ
NAFITSANTFVVGMTKSKVLAVSLWTGSITKKFCCEDGITIVNFKLIPDCPDIIVFITSA
ETVNLWSLTDEVICRRVQLPSNFLKNLEDFEISPNGKLGIISRGDENINVLDLHSGKLRV
VHASGVIWRQRLSRDGRYLVYICFQNGEEEEENDTVSSLIVMRLADGKNIGACSLYKTPT
FLALSQRHLNIIVGFDDGSIGIYTVVDRVDAALKIKIATSNSRQIFSNATQTSRPKSNSY
SFKVSVDCLWRESTEVFARDSPITVSDSSESNEATPSKKHNSCYDRVCAALESRSHSYTS
DN
Download sequence
Identical sequences ENSRNOP00000002978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]