SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003182 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003182
Domain Number 1 Region: 5-433
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-132
Family ALDH-like 0.000000000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003182   Gene: ENSRNOG00000002331   Transcript: ENSRNOT00000003182
Sequence length 453
Comment pep:known chromosome:Rnor_5.0:10:47264967:47274685:1 gene:ENSRNOG00000002331 transcript:ENSRNOT00000003182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLGKNEWTSY
YEEVAHVLEELDTTIKELPDWAEDEPVAKTRQTQQDDLYIHSEPLGVVLVIGAWNYPFNL
TIQPMVGAVAAGNAVILKPSEVSGHMADLLATLIPQYMDQNLYLVVKGGVPETTELLKER
FDHIMYTGSTAVGKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKDFYGEDAKQSRDYGRIINDRHFQRVKGLIDN
QKVAHGGTWDQSSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREK
PLALYVFSNNEKVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFE
TFSHRRSCLVKSLLNEEAHKARYPPSPAKMPRH
Download sequence
Identical sequences P11883
ENSRNOP00000003182 ENSRNOP00000003182 NP_114178.1.100692 NP_114178.1.4139 10116.ENSRNOP00000003182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]