SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003431 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003431
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.56e-18
Family THAP domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003431   Gene: ENSRNOG00000002543   Transcript: ENSRNOT00000003431
Sequence length 217
Comment pep:known chromosome:Rnor_5.0:14:17523509:17533559:-1 gene:ENSRNOG00000002543 transcript:ENSRNOT00000003431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNTAGIWEPKKGDV
LCSRHFKKTDFDRSTPNTKLKPGAIPSVFESPCHLQEKREKLHCRKNFILKTLPVSNRGH
QLVGASCIAEFQPQLIFKQSTDSMQSPLKFQKQKTSSVILELENTKESLQNVLDREKHFQ
KSLRKTIRELKDESLISQETASRLDAFCWECCQESTA
Download sequence
Identical sequences ENSRNOP00000003431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]