SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003553 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003553
Domain Number 1 Region: 46-275
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.31e-69
Family Carbonic anhydrase 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003553   Gene: ENSRNOG00000002626   Transcript: ENSRNOT00000003553
Sequence length 297
Comment pep:novel chromosome:Rnor_5.0:10:80633889:81131156:1 gene:ENSRNOG00000002626 transcript:ENSRNOT00000003553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLC
SVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVRGPMTYSHRLEEIRLHFGSEDSQGSE
HLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDT
ITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQM
HSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYR
Download sequence
Identical sequences ENSRNOP00000003553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]