SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003777 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003777
Domain Number 1 Region: 957-1154
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000132
Family WD40-repeat 0.036
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000003777
Domain Number - Region: 490-543
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00235
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003777   Gene: ENSRNOG00000002749   Transcript: ENSRNOT00000003777
Sequence length 1320
Comment pep:known chromosome:Rnor_5.0:10:81527102:81660894:1 gene:ENSRNOG00000002749 transcript:ENSRNOT00000003777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTR
VESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLH
QLSGSEQLEATAHSRIRKERPISLGIFPLPAGDGLLTPDTQKGGETPGSEQWKFQELSQP
RSHTSLKDELSDISQGGSKATTPASTANSDVSAIPPDTPSKEDNEGLVKGTDTPNKAEIS
KHIEVQVAQETRNVSTDSAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIENKA
FDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQLLETKNALNVVKNDL
IAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSD
IPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQ
FFSRLFSSSSNAAKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEET
EASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVANGQGENKMKNLPVPVY
LRPLDEKDASMKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVSALESEGSKQRSASQSSL
DKLDQELKEQQKELKNQEELSSQVWICTSTHSTTKVIIIDAVQPGNILDSFTVCNSHVLC
IASVPGARETDYPAGEELSDSGQVDRASLCGSMTSNSSAEMDSLLGGITVVGCSTEGVTG
AAASPSTNGASPVIEKPPEVEAENSEIDENIPTAEEATEATEGNAGSTEDAVDISQPGVY
TEHVFTDPLGVQIPEDLSPVFQSSNDSDVYKDQISVLPNEQDLAREEAQKMSSLLPTMWL
GAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGLDGQWD
LSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQ
LAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVS
CNRLWVGTGNGVIISIPLTETVILHQGRLLGLRANKTSGTPGNRPGSVIRVYGDENSDKV
TPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVVSPQSSSSGADLTADKAGSSAQEPS
SQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMCGNE
Download sequence
Identical sequences E9PSJ4
ENSRNOP00000003777 NP_001101760.2.100692 NP_001101760.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]