SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003946 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003946
Domain Number 1 Region: 1-170
Classification Level Classification E-value
Superfamily E set domains 2.2e-71
Family Arrestin/Vps26-like 0.000000504
Further Details:      
 
Domain Number 2 Region: 173-371
Classification Level Classification E-value
Superfamily E set domains 4.55e-57
Family Arrestin/Vps26-like 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003946   Gene: ENSRNOG00000002904   Transcript: ENSRNOT00000003946
Sequence length 380
Comment pep:known chromosome:Rnor_5.0:X:71311677:71323656:1 gene:ENSRNOG00000002904 transcript:ENSRNOT00000003946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRVFKKTSSNGKFSIYLGKRDFVDDVDTVEPIDGVILVDPEYLKGRKMFVRLTCAFRYGR
DDLDVIGLTFRKDLYVQTKQVAPAEPTSIQGPLTALQERLLHKLGVNAYPFTLQMVANLP
CSVTLQPGPEDSGKPCGVDFEVKSFCAENLEEKISKSDSVQLVVRKVQFSALEPGPGPWA
QTIRSFFLSSQPLQLQAWMDREVHYHGEAISVHVSINNYTNKVIRRIKIAVIQITDVVLY
SLDKYTKTVFIREFTETVAANSSFSQTFAVTPLLAANRQKQGLALDGKLKHEDTNLASST
ILRPGMNKELLGILVSYKVKVNLMVSYGGILGGLPASDVGVELPLILIHPKPPHGERAVA
TSSEDIVVEEFMQQNSQTQS
Download sequence
Identical sequences F1LMR6
ENSRNOP00000003946 ENSRNOP00000003946 10116.ENSRNOP00000003946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]