SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004477 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004477
Domain Number 1 Region: 403-433,466-570,692-807
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.82e-56
Family Phosphate binding protein-like 0.0000000828
Further Details:      
 
Domain Number 2 Region: 35-401
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.42e-22
Family L-arabinose binding protein-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004477   Gene: ENSRNOG00000003280   Transcript: ENSRNOT00000004477
Sequence length 1250
Comment pep:known chromosome:Rnor_5.0:10:104480212:104497817:1 gene:ENSRNOG00000003280 transcript:ENSRNOT00000004477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALVSLQDPPVDMGGALGPALLLTSLLGAWARLGAGQGEQAVTVAVVFGSSGPLQTQAR
TRLTSQNFLDLPLEIQPLTVGVNNTNPSSILTQICGLLGAARVHGIVFEDNVDTEAVAQL
LDFVSSQTHVPILSISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAV
ITSLHPGHALFLEGVRAVADASYLSWRLLDVLTLELGPGGPRARTQRLLRQVDAPVLVAY
CSREEAEVLFAEAAQAGLVGPGHVWLVPNLALGSTDAPPAAFPVGLISVVTESWRLSLRQ
KVRDGVAILALGAHSYRRQYGTLPAPAGDCRSHPGPVSPAREAFYRHLLNVTWEGRDFSF
SPGGYLVRPTMVVIALNRHRLWEMVGRWDHGVLYMKYPVWPRYSTSLQPVVDSRHLTVAT
LEERPFVIVESPDPGTGGCVPNTVPCRRQSNHTFSSGDLTPYTKLCCKGFCIDILKKLAK
VVKFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFV
ETGISVMVSRSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLT
KGKKPGGPSFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANL
AAFMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFN
QRSVEDALTSLKMGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDS
HWKRAIDLALLQLLGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMG
LALLVFAWEHLVYWKLRHSVPNSSQLDFLLAFSRGIYSCFNGVQSLPSPARPPSPDLTAD
SAQANVLKMLQAARDMVNTADVSSSLDRATRTIENWGNNRRVPAPTASGPRSSTPGPPGQ
PSPSGWGPPGGGRTPLARRAPQPPARPATCGPPLPDVSRPSCRHASDARWPVRVGHQGPH
VSASERRALPERSLLPAHCHYSSFPRAERSGRPYLPLFPEPPEPDDLPLLGPEQLARREA
MLRAAWARGPRPRHASLPSSVAEAFTRSNPLPARCTGHACACPCPQSRPSCRHLAQAQSL
RLPSYPEACVEGVPAGVATWQPRQHVCLHAHTRLPFCWGTVCRHPPPCTSHSPWLIGTWE
PPAHRVRTLGLGTGYRDSGVLEEVSREACGTQGFPRSCTWRRVSSLESEV
Download sequence
Identical sequences A0A0G2JSH8
NP_036707.3.100692 NP_036707.3.4139 XP_006247769.1.100692 XP_017452475.1.100692 XP_017452476.1.100692 XP_017452477.1.100692 XP_017452478.1.100692 XP_017452479.1.100692 10116.ENSRNOP00000004477 ENSRNOP00000004502 ENSRNOP00000004477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]