SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004684 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000004684
Domain Number - Region: 62-111
Classification Level Classification E-value
Superfamily Plus3-like 0.0353
Family Plus3 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004684   Gene: ENSRNOG00000003532   Transcript: ENSRNOT00000004684
Sequence length 314
Comment pep:known chromosome:Rnor_5.0:X:141875018:141880224:1 gene:ENSRNOG00000003532 transcript:ENSRNOT00000004684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRQKHDQGLEGQLGEEVPAAKEVSAAEESQDTSSSSASVQATAPSKASKVSGDQAAGG
QSTSKAYLYSKFLLNSNLQKKVTDLVKFLSFKYITNEPVTEAEIQKHVVKEYKGYYALIF
RHACECMEVVFGIEVKEVDSLNHTYKLLKILDLTYDGRISNEEGIPKTGLLVLILGVIFM
EGNRASEKKIWDVLSVVGMYPDRHDFICGDPRKFITEDLVLENYLVYQPIPNSDPTSYEF
LWGPRAQAETSKMKVLQFFSKVAGSSPTSFTALYKEALKDEEERARALLASTAISTAADN
LGSGEKPSSVSHPE
Download sequence
Identical sequences Q5XIK4
ENSRNOP00000004684 ENSRNOP00000004684 10116.ENSRNOP00000004684 NP_001013984.1.100692 NP_001013984.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]