SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004938 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004938
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily UBC-like 1.27e-58
Family UFC1-like 0.0000000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004938   Gene: ENSRNOG00000003706   Transcript: ENSRNOT00000004938
Sequence length 167
Comment pep:known chromosome:Rnor_5.0:13:94288628:94295639:-1 gene:ENSRNOG00000003706 transcript:ENSRNOT00000004938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNK
EGTRWFGKCWYIHDFLKYEFDIEFEIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDH
FKPLWARNVPKFGLAHLMALGLGPWLAVEVPDLIQKGVIQHKEKCNQ
Download sequence
Identical sequences Q6BBI8
10116.ENSRNOP00000004938 ENSRNOP00000004938 NP_001003709.1.100692 NP_001003709.1.4139 XP_006250313.1.100692 ENSRNOP00000004938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]