SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005031 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005031
Domain Number 1 Region: 31-261
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.23e-74
Family Eukaryotic type heme oxygenase 0.00000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005031   Gene: ENSRNOG00000003773   Transcript: ENSRNOT00000005031
Sequence length 315
Comment pep:known chromosome:Rnor_5.0:10:9756667:9772409:-1 gene:ENSRNOG00000003773 transcript:ENSRNOT00000005031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEVETSEGVDESENNSTAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGN
IKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKEALIKDMEYFFGENW
EEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTG
EGTQFYLFEHVDNAQQFKQFYRARMNALDLSMKTKERIVEEANKAFEYNMQIFSELDQAG
SMLTKETLEDGLPVHDGKGDVRKCPFYAAQPDKGTLGGSNCPFRTAMAVLRKPSLQLILA
ASVALVAGLLAWYYM
Download sequence
Identical sequences P23711
ENSRNOP00000005031 NP_001264002.1.100692 NP_001264002.1.4139 NP_077363.1.100692 NP_077363.1.4139 XP_006245889.1.100692 10116.ENSRNOP00000005031 ENSRNOP00000005031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]