SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005039 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005039
Domain Number 1 Region: 220-283
Classification Level Classification E-value
Superfamily RILP dimerisation region 1.11e-17
Family RILP dimerisation region 0.0000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005039   Gene: ENSRNOG00000003784   Transcript: ENSRNOT00000005039
Sequence length 366
Comment pep:known chromosome:Rnor_5.0:10:64344730:64347883:-1 gene:ENSRNOG00000003784 transcript:ENSRNOT00000005039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRRAAPGLLSQASLVGTGSVAELVYHLAGALGTELQELARRFGPDAAAGLVPLVVRAL
ELLEKAAVGPAPDWVSTQQAEVELRRLREENQRLRQELGSEPQEERALLRQLKEVTDRQR
DELRAHNRDLLRRSQETEALQEQLQRLLLVNSELRHKLAAVQTQLRAARDRERERQTARD
RSQQLAKEQSLEPDAATPDDPVDAQKQSGNPPEAVQCGFSREEVEQILQERNELKANVFL
LKEELAYFQREMLTDHRVPGLLLEAMKVAVKKQRRKIKAKMLGTPEEAESSDDEDGSWLL
LSNDKEDVPLVPGSRIQNFFGLWYQGETEAPEAETSNTAPSRTQEGEGAPPQPYLQPVDN
LPAPSS
Download sequence
Identical sequences D3ZGA5
NP_001099281.1.100692 NP_001099281.1.4139 ENSRNOP00000005039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]