SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005089 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005089
Domain Number 1 Region: 54-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 9.55e-48
Family Ribosomal protein S7 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005089   Gene: ENSRNOG00000003797   Transcript: ENSRNOT00000005089
Sequence length 242
Comment pep:known chromosome:Rnor_5.0:10:104122365:104125390:-1 gene:ENSRNOG00000003797 transcript:ENSRNOT00000005089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALRAARRWSGLALGVRCAVWNLPGITQVRWSRYAPEFRDPLIDKEHYRKQVSELTE
EEKYDLELKKTQLIKAAAATETSSVFADPVISKFTNMMMKGGNKVLARSLMAQTLEAVKR
KQFEKYRAASAEEQATIERNPYKIFHEALRNCEPVIGLVPILKGGHFYQVPVPLADRRRR
FLAMKWMITECRENKPRRMLMPEKLSHELLEAFHNRGPVIKRKHNMHKMAEANRALAHYR
WW
Download sequence
Identical sequences Q5I0K8
10116.ENSRNOP00000005089 NP_001093941.1.100692 NP_001093941.1.4139 ENSRNOP00000005089 ENSRNOP00000005089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]