SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006143 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006143
Domain Number 1 Region: 357-590
Classification Level Classification E-value
Superfamily HCP-like 3.31e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 564-698
Classification Level Classification E-value
Superfamily HCP-like 1.96e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 197-321
Classification Level Classification E-value
Superfamily HCP-like 1.31e-24
Family HCP-like 0.0036
Further Details:      
 
Domain Number 4 Region: 115-168
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006143   Gene: ENSRNOG00000004464   Transcript: ENSRNOT00000006143
Sequence length 792
Comment pep:known chromosome:Rnor_5.0:6:124826559:124868279:-1 gene:ENSRNOG00000004464 transcript:ENSRNOT00000006143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVRVRLLLLLCAVLLGSAAASSDEETNQDESLDSKGALPTDGSVKDHTTGKVVLARDLL
ILDSEVESLLQDEEESSKSQEEVSVTEDISFLDSPNPSSKTYEELKRVRKPVLTAIEGTA
HGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKTDEKWGFCETEEDAAKRRQMQE
AEAIYQSGMKILNGSTRKNQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLTQNIQAA
KEMFEKLTEEGSPKGQTGLGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYRYW
AGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLIQ
YYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYSE
GSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGW
VDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHTA
VELFKNVCERGRWSERLMTAYNSYKDDDYNAAVVQYLLLAEQGYEVAQSNAAFILDQREA
TIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQH
SAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQYIR
EANIRDLFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDIPVPRPPGPRPAPP
QQEGPPEQQPPQ
Download sequence
Identical sequences F1LQ92
ENSRNOP00000006143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]