SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006531 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006531
Domain Number 1 Region: 89-223
Classification Level Classification E-value
Superfamily FKBP-like 1.63e-36
Family FKBP immunophilin/proline isomerase 0.00000106
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000006531
Domain Number - Region: 25-88
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00273
Family Mevalonate 5-diphosphate decarboxylase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006531   Gene: ENSRNOG00000004629   Transcript: ENSRNOT00000006531
Sequence length 224
Comment pep:known chromosome:Rnor_5.0:6:96299844:96311094:-1 gene:ENSRNOG00000004629 transcript:ENSRNOT00000006531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDSFLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFESKRFKGTETISKVSEQVKNVKLNDDKQKDSKSEETLDEGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVDID
Download sequence
Identical sequences G3V6L9
ENSRNOP00000006531 NP_001100206.2.100692 NP_001100206.2.4139 ENSRNOP00000006531 10116.ENSRNOP00000006531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]