SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006566 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006566
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 9.81e-27
Family Arylsulfatase 0.038
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000006566
Domain Number - Region: 153-176
Classification Level Classification E-value
Superfamily dUTPase-like 0.00669
Family dUTPase-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006566   Gene: ENSRNOG00000046159   Transcript: ENSRNOT00000006566
Sequence length 186
Comment pep:known chromosome:Rnor_5.0:7:65824339:65858941:1 gene:ENSRNOG00000046159 transcript:ENSRNOT00000006566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVSNIDLGPTILDLAGYDLNKTQMDGTSLLPILKGDGNLTWRSDVLVEYQGEGRNVTDP
TCPSLSPGVSQCFPDCVCEDAYNNTYACVRTLSSMWNLQYCEFDDQEVFVEVYNITADPD
QITNIAKSIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDLRLMFSNHGSIRMRR
FSKHPL
Download sequence
Identical sequences ENSRNOP00000006566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]