SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006852 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006852
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.00000185
Family DNA polymerase processivity factor 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006852   Gene: ENSRNOG00000005141   Transcript: ENSRNOT00000006852
Sequence length 280
Comment pep:known chromosome:Rnor_5.0:14:88991468:89006201:-1 gene:ENSRNOG00000005141 transcript:ENSRNOT00000006852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQ
ENFFSEFQMEGVSEENNEIYLELTSENLARALKTAQNARALKIKLTNKHFPCLTVSVELL
SSSSSSRIVVHDIPIKVIPRRLWKDLQEPSIPESDVSIYLPALKTMKSVVDKMRNISNHL
VIEANLKGELNLKIETESVCVTTHFKDLENPLLPSDSVSQNRHPEDMAKVHIDIRKLLQL
LAGQQVAPTKAVCNIVNNRTIHFDLLLEDVSLQYFIPALS
Download sequence
Identical sequences D3ZNA8
NP_001102562.1.100692 NP_001102562.1.4139 XP_006251530.1.100692 ENSRNOP00000006852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]