SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006883 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006883
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.25e-59
Family Ran-binding protein mog1p 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006883   Gene: ENSRNOG00000004980   Transcript: ENSRNOT00000006883
Sequence length 185
Comment pep:known chromosome:Rnor_5.0:10:55301089:55302460:-1 gene:ENSRNOG00000004980 transcript:ENSRNOT00000006883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPARNCPLFGGAFSAILPRGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQG
EAAARYHFEDVGGVQGARSVHVLSVQPLCLENLSLRGCCQDAWFLSGKQQVAKENQQVAK
DVTLHQALLRLPQYQTDLLLTFNQPPCHSRPLGPENLSCPPWSLGNFEQLVTSLTLHDPN
LFGPQ
Download sequence
Identical sequences D3ZMP9
ENSRNOP00000006883 NP_001099260.1.100692 NP_001099260.1.4139 10116.ENSRNOP00000006883 ENSRNOP00000006883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]