SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007768 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007768
Domain Number 1 Region: 1048-1096
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 1.18e-17
Family Nuclear receptor coactivator interlocking domain 0.00013
Further Details:      
 
Domain Number 2 Region: 264-369
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000023
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.001
Further Details:      
 
Domain Number 3 Region: 122-187
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000209
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 4 Region: 35-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000746
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007768   Gene: ENSRNOG00000005616   Transcript: ENSRNOT00000007768
Sequence length 1398
Comment pep:known chromosome:Rnor_5.0:3:168933287:168958994:1 gene:ENSRNOG00000005616 transcript:ENSRNOT00000007768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGESSLDPLATESRKRKLPCDAPGQGLVYSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEQDRKDFLKHVPKSTVN
GVSWTNENQRQKSHTFNCRMLMKTHDILEDTNASPETRQRYETMQCFALSQPRAMLEEGE
DLQCCMICVARRVTTDRPFPSSPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDTIRRCI
QRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTNDRH
GFVSTHFLQREQNGCRPNPNPVGQGIRPPAAGCGMSLSPSQSVQMLGSRTYGVADPSNTG
QMAGARYGASSSVASLTPGQSLQSPSSYQSNSYGLNMSSPPHGSPGLGPNQQNIMISPRN
RGSPKMASHQFSPAAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLSTLSSPGP
KLDNSPNMNINQPSKASSQDSKSPLGLYCEQNPVESSVCPSNSRDHPSDKENKENSGEAS
ETPRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSNCKDSSISVTSPSGVSSSTSGA
VSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASGGEGSVRQEQL
SPKKKENNALLRYLLDRDDPSDVLAKELQPQADGGDSKLSQCSCSTNPSSGQEKDPKIKT
EASEEVSGDLDNLDAILGDLTSSDFYNSPTNGSHPGAKQQMFAGPSSLGLRSPQPVQSVR
PPYNRALSLDSPVSVGSVPPVKNVSAFPVLPKQPILAGNPRMMDSQENYGANMGGPNRNV
PVNPTSSSGDWGLANSRASRMEPLASSPLGRAGGDYSAALPRPALGSSGPTLPLRSNRLP
GARPTLQPQPQPQQQQQQQQQQQQQQQMLQMRAGEVPMGMGVSPYSPAVPSNQPGSWPEG
MLSMEQGPHGAQNRPLLRNSLDELLGPPSNPEGQSDERALLDQLHTLLSNTDATGLEEID
RALGIPELVSQGQALESKQDVFQGQEAAVMMDQKAALYGQTYPAQGPPLQGGFHLQGQSP
SLNSMMSQISQQGSFPLQGLHPRASMVRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEM
KMESPTGAAVMRPMLHQAFFNAQMAAQQKRELMNHHLQQQRMAMMMSQPQPQAFSPPPNV
TASPSMDGVLAGSAMPQAPPQQFPYATNYGMGQPPEPAFGRGSSPPSAMMSSRMGPSQNA
MVQHPQTAPMYQSSEMKGWPSGNLARNGSFPQQQFAPQANPAAYNMVHMNSSGSHLGQMT
MTPMPMSGMPMGPDQKYC
Download sequence
Identical sequences ENSRNOP00000007768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]