SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007802 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007802
Domain Number 1 Region: 28-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.66e-79
Family Carbonic anhydrase 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007802   Gene: ENSRNOG00000005669   Transcript: ENSRNOT00000007802
Sequence length 290
Comment pep:known chromosome:Rnor_5.0:5:26010376:26106856:-1 gene:ENSRNOG00000005669 transcript:ENSRNOT00000007802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSFIEDAVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREAR
YDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHWG
RENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIVIIALFVQIGKEHVGLK
AVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPL
TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences Q5PPN4
10116.ENSRNOP00000007802 NP_001009662.1.100692 NP_001009662.1.4139 ENSRNOP00000007802 ENSRNOP00000007802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]