SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007999 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007999
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.55e-63
Family Alanine racemase-like, N-terminal domain 0.000000141
Further Details:      
 
Domain Number 2 Region: 248-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.56e-30
Family Eukaryotic ODC-like 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007999   Gene: ENSRNOG00000005333   Transcript: ENSRNOT00000007999
Sequence length 448
Comment pep:known chromosome:Rnor_5.0:7:77448675:77475344:-1 gene:ENSRNOG00000005333 transcript:ENSRNOT00000007999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYMVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIYTSPCKQASQI
KYAAKVGVNIMTCDNEVELKKIARNHPNAKVLLHIATEDNIGGEDGNMKFGTTLKNCRHL
LECAKELDVQIIGVKFHISSACKEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTG
TEIQLEEVNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVENDKLSS
GVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTVPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELSVGDWLIFDNMGADSLHGPSAFSDTQRPAIYFMMSLSDWYEMQDAGI
TSDAMMKNFFFAPSCIQLSQEDNFSTEA
Download sequence
Identical sequences Q6P7R3
ENSRNOP00000007999 10116.ENSRNOP00000007372 ENSRNOP00000007372 NP_001288631.1.100692 NP_001288631.1.4139 NP_072107.2.100692 NP_072107.2.4139 XP_006241630.1.100692 XP_008763679.1.100692 XP_017450557.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]