SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008062 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008062
Domain Number 1 Region: 18-117
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 1.52e-23
Family 4'-Phosphopantetheinyl transferase SFP 0.0062
Further Details:      
 
Domain Number 2 Region: 125-249
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 2.22e-23
Family 4'-Phosphopantetheinyl transferase SFP 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008062   Gene: ENSRNOG00000005795   Transcript: ENSRNOT00000008062
Sequence length 309
Comment pep:known chromosome:Rnor_5.0:8:1433781:1444562:-1 gene:ENSRNOG00000005795 transcript:ENSRNOT00000008062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPAKRLCVVPYMEGVRWAFSCGTWLPSPAEWLLAVRSIQPEEKERIGQFVFARDAKAA
LAGRLMIRKLVAEKLNIPWDHIRLQRTSKGKPILAKDTLNPYPNFNFNISHQGDYTVLAA
EPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFNDEWSQLDMFYRHWALK
ESFIKAIGVGLGFEMQRLEFDVSPLSMDIGQVYKETRLILDGEEEKEWAFEESKIDQHHF
VAVALRKPDGSRHQNVSYQDDSKPSQRQFTILNFNDLIASAIPMTPEDPSFWDCFCFTEE
ILIRNGSKS
Download sequence
Identical sequences B2RYJ4
NP_001100268.2.100692 NP_001100268.2.4139 ENSRNOP00000007764 10116.ENSRNOP00000008062 ENSRNOP00000008062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]