SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008737 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008737
Domain Number 1 Region: 29-144
Classification Level Classification E-value
Superfamily FKBP-like 1.02e-42
Family FKBP immunophilin/proline isomerase 0.000000716
Further Details:      
 
Domain Number 2 Region: 259-414
Classification Level Classification E-value
Superfamily TPR-like 9.97e-34
Family Tetratricopeptide repeat (TPR) 0.000000127
Further Details:      
 
Domain Number 3 Region: 142-256
Classification Level Classification E-value
Superfamily FKBP-like 4.12e-28
Family FKBP immunophilin/proline isomerase 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008737   Gene: ENSRNOG00000006444   Transcript: ENSRNOT00000008737
Sequence length 458
Comment pep:known chromosome:Rnor_5.0:4:226954534:226962988:-1 gene:ENSRNOG00000006444 transcript:ENSRNOT00000008737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEEMKVAENGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETAMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGSAGSPP
KIPPNATLVFEVELFEFKGEDLTEDEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYYND
RLFDQRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKERFQIPPH
AELRYEVHLKSFEKAKASWEMNSEEKLEQSNIVKERGTVYFKEGKYKQALLQYKKIVSWL
EYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLAE
EEHKAKTEVAAGDHPTDAEMKGEPNNVAGNQAQVKTEA
Download sequence
Identical sequences Q9QVC8
NP_001178792.1.100692 NP_001178792.1.4139 ENSRNOP00000008737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]