SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009462 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009462
Domain Number 1 Region: 49-462
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.57e-100
Family Iron-containing alcohol dehydrogenase 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009462   Gene: ENSRNOG00000007069   Transcript: ENSRNOT00000009462
Sequence length 467
Comment pep:known chromosome:Rnor_5.0:5:14202076:14228623:-1 gene:ENSRNOG00000007069 transcript:ENSRNOT00000009462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARARVTHLLRHLQSTACQCPTHSHTYSQVPGLSPSGKTTDYAFEMAVSNIRYGAGV
TKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDNVRVEPTDGSFM
DAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYACSPHSEFLDYVNAPIGKGKPVTVPLKP
LIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVVANSG
FDVLCHALESYTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALRIVAKYLKRAVRN
PDDLEARSSMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKEYNVDHPLVPHGLS
VVLTSPAVFTFTAQMFPERHLETAEILGANIRTAKIQDAGPVLADALRKFLFDLNVDDGL
AALGYSKDDIPSLVKGTLPQERVTKLAPRAQSEEDLSALFEASMKLY
Download sequence
Identical sequences Q4QQW3
10116.ENSRNOP00000009462 ENSRNOP00000009462 NP_001020594.1.100692 NP_001020594.1.4139 ENSRNOP00000009462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]