SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009764 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009764
Domain Number 1 Region: 486-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.19e-58
Family Eukaryotic proteases 0.000000011
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily Kringle-like 2.13e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 211-294
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-34
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 303-386
Classification Level Classification E-value
Superfamily Kringle-like 9.67e-32
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 382-478
Classification Level Classification E-value
Superfamily Kringle-like 1.79e-28
Family Kringle modules 0.00041
Further Details:      
 
Domain Number 6 Region: 37-126
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.71e-22
Family Hairpin loop containing domain 0.00000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009764   Gene: ENSRNOG00000007027   Transcript: ENSRNOT00000009763
Sequence length 728
Comment pep:known chromosome:Rnor_5.0:4:15410059:15478680:-1 gene:ENSRNOG00000007027 transcript:ENSRNOT00000009763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWGTKLLPVLLLQHVLLHLLLLPVTIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLVKI
KTKKVNSADECANRCIRNKGFPFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSAVNETDVP
METTECIKGQGEGYRGTTNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLTKNYCRNPDDDAHGPWCYTGNPLVPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
Download sequence
Identical sequences P17945
ENSRNOP00000009764 NP_058713.1.100692 NP_058713.1.4139 ENSRNOP00000009764 10116.ENSRNOP00000009764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]