SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009859 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009859
Domain Number 1 Region: 348-385
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000471
Family Retrovirus zinc finger-like domains 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000009859
Domain Number - Region: 326-347
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0523
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009859   Gene: ENSRNOG00000007520   Transcript: ENSRNOT00000009859
Sequence length 400
Comment pep:novel chromosome:Rnor_5.0:3:154226833:154228035:-1 gene:ENSRNOG00000007520 transcript:ENSRNOT00000009859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGSGAEEEPQRGRPELPLPARPVARAEESEGVREKMGWAQVVKNLAEKKGDFREPRRR
DEAGSGASGGLGSSGSLAAPNPGDFPPAARGDPKGRRRDPTGEAADAYRKKGASSAGDPS
RRKKADVSAAMPTPARSGATEDATERPLQDEPPAAGPGKGRFLVRICFQGDESACPTRDF
VVGALILRSIGMDPDDIYAVIQIPGSREFDVSFRSAEKLALFLRVYEEKRELEDCWENFV
VLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIEL
RQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGTCTQDRCFRCGEEGHLS
PYCRKVIVCNLCGKRGHAFAQCPKAVHNSMAAQLTGLAGH
Download sequence
Identical sequences D3ZZ10
10116.ENSRNOP00000009859 ENSRNOP00000009859 XP_001072887.2.100692 XP_002726297.1.4139 ENSRNOP00000009859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]