SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010533 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010533
Domain Number 1 Region: 172-319
Classification Level Classification E-value
Superfamily TPR-like 9.59e-23
Family Tetratricopeptide repeat (TPR) 0.0025
Further Details:      
 
Domain Number 2 Region: 6-93,131-157
Classification Level Classification E-value
Superfamily FKBP-like 1.96e-16
Family FKBP immunophilin/proline isomerase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010533   Gene: ENSRNOG00000007889   Transcript: ENSRNOT00000010533
Sequence length 328
Comment pep:known chromosome:Rnor_5.0:10:58340804:58349923:-1 gene:ENSRNOG00000007889 transcript:ENSRNOT00000010533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSLLLNVEGVKKTILHGGTGELPNFITGSRVTFHFRTMKCDEERTVIDDSKQVGQPMN
IIIGNMFKLEVWETLLTSMRLGEVAEFWCDTIHTGVYPMLSRSLRQVAEGKDPTSWHVHT
CGLANMFAYHTLGYEDLDELQKEPQPLIFLIELLQVEAPNEYQRETWNLNNEERMQAVPL
LHGEGNRLYKLGRYDQAATKYQEAIVCLRNLQTKEKPWEVEWLKLEKMINTLILNYCQCL
LKKEEYYEVLEHTSDILRHHPGIVKAYYMRARAHAEVWNAEEAKADLEKVLELEPSMRKA
VLRELRLLESRLADKQEEERQRCRSMLG
Download sequence
Identical sequences Q9JLG9
10116.ENSRNOP00000010533 NP_067601.1.100692 NP_067601.1.4139 XP_017452988.1.100692 ENSRNOP00000010533 ENSRNOP00000010533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]